Protein Info for EX31_RS02260 in Rahnella sp. WP5
Annotation: chitin disaccharide deacetylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 65% identical to CHBG_CITK8: Chitooligosaccharide deacetylase (chbG) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
KEGG orthology group: K03478, hypothetical protein (inferred from 98% identity to rah:Rahaq_4648)Predicted SEED Role
"Cellobiose phosphotransferase system YdjC-like protein" in subsystem Beta-Glucoside Metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>EX31_RS02260 chitin disaccharide deacetylase (Rahnella sp. WP5) MDKLLIVNADDFGLCKAQNYGIIDAFNNGVVRSTTAMVNMAGAEHAAVLSKENPDLAVGM HFVLTLGRPLSSMPGLARDGELGKWIWEMAEQGTLPLDEIAQELQCQFGRFVSLFGRLPT HLDSHHHVHMFPQIFPIVEAFAKDQGIPVRIDRDEIRRGDIALCGAKSTDGFDSSFYGET VSEALFVQTLDNATQRGDRSVEIMTHPAFIDNTLLASKYCYPRLAELDVLTSASLKTAIT ERGFRLGSFKDL