Protein Info for EX31_RS02090 in Rahnella sp. WP5

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 69% identical to UGL_BURCM: Ureidoglycolate lyase (Bamb_4846) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4612)

MetaCyc: 77% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Burkholderia multivorans)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"2,4-diketo-3-deoxy-L-fuconate hydrolase" in subsystem L-fucose utilization temp

MetaCyc Pathways

L-fucose degradation III (6/8 steps found)
D-arabinose degradation IV (2/6 steps found)
D-xylose degradation VI (1/5 steps found)
L-rhamnose degradation III (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>EX31_RS02090 fumarylacetoacetate hydrolase family protein (Rahnella sp. WP5)
MKLLRYGNAGSERPGLLDDNGTLRDLSAHIADISGEFLQPETLDKLRQLDPHTLPLVGGE
PRLGACVGKVGKFICIGLNYADHAAETGAEIPKEPVVFSKWTSAMVGPNDDVEIPRDSVK
TDWEVELGVVIGTGGRYISEADAMSHVAGYCVINDVSEREFQIERGGTWDKGKGCDTFGP
TGPWLVTADEIPDPHQLNLWLEVDGKRWQNGNTRTMIFQIPEIISYLSRFMSLQPGDIIS
TGTPPGVGLGQKPPVYLKAGQVMRLGIEGLGEQRQKTVQA