Protein Info for EX31_RS02065 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 114 to 114 (1 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 360 (331 residues), 121.3 bits, see alignment E=4.6e-39 PF00083: Sugar_tr" amino acids 57 to 197 (141 residues), 36 bits, see alignment E=4e-13

Best Hits

Swiss-Prot: 44% identical to NEPI_SALEP: Purine ribonucleoside efflux pump NepI (nepI) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4606)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>EX31_RS02065 MFS transporter (Rahnella sp. WP5)
MNHKTEGSAPATQQDVQQAPPAWMAVFSLTMGVFGLLTAEYLPASLLTPMASDLQVTEAL
AGQAVTVTAVIALFAGLLVPGLTRKLDRRTVLLSFTVLMIASNLLVALSSSLAVLLVMRI
LLGVALGGFWSMAAAVAMRLVPEKLVPRALSVIFSGIAVGTVVSVPLGSFLGELYGWRSA
FIAAALVGGVTLAFQWFTLPRMAPRQVTHIASVLTLLRRPGIATGMSGCVLAHTGQYALF
TYIRPSLESVSHVDVGGLALLLLGFGVANFAGTLLAGWIMTYSLRLTLIVMPCLVGIAAL
GMILLPVQITGLTLLVLLWGLAFGGVPVAWSNWVTRSVPDQAESAGGMVVAAVQSSIAAG
AALGGVMFGLGGISGVFITAGIVMLSAALIIALCVRVGLSGDGAETPSLQHE