Protein Info for EX31_RS01995 in Rahnella sp. WP5

Annotation: type VI secretion protein ImpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF06812: ImpA_N" amino acids 3 to 110 (108 residues), 80.2 bits, see alignment E=1.3e-26 PF12486: VasL" amino acids 299 to 445 (147 residues), 152.2 bits, see alignment E=1e-48

Best Hits

KEGG orthology group: K11911, type VI secretion system protein VasL (inferred from 98% identity to rah:Rahaq_4591)

Predicted SEED Role

"HecB-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>EX31_RS01995 type VI secretion protein ImpA (Rahnella sp. WP5)
MSIERQLRTGDDPRALADYAVLREELSKLTHPARPDVDWKKVEHLCLNLFQQNGIELQTA
SWYTQARARLAGMPGLNEGLAILEALISRQWPGLWPQPVHARMEILSGLSQRLQQILRGM
SLEYHDLSQIYQAEKLIASLCNVLQRLELKHVSQLEALTSFMHGTAVRLENMHATSDAAI
VLPAAAAEKAEKEWTAQPGEQWVYVAQSGPAEPHVIAPPSPVKRPVQWKGFIAGIVVTAL
ASTGFKAGIDAFYHPQTAEQLMATLPVLPKSLNAQALETLKNQQAEMLHREAPAFLAATQ
QQTRQLAALSPRWAQDTGAQLVKQAQILWPDNPASQQLAKNWTQQLNASAIPQENLDGWQ
QANTQLQQLADKLNGLDEQRGKYMTVSQLKSSVFAIQQALNSSPPVEESLRKLAQDKQQQ
KGISPQRIMQLDNQFTQLLNRYVLLLQNLPATTEKNGQADH