Protein Info for EX31_RS01945 in Rahnella sp. WP5

Annotation: type VI secretion system tip protein VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 835 TIGR03361: type VI secretion system Vgr family protein" amino acids 20 to 526 (507 residues), 262.6 bits, see alignment E=6.4e-82 TIGR01646: Rhs element Vgr protein" amino acids 31 to 521 (491 residues), 334.1 bits, see alignment E=1.6e-103 PF05954: Phage_GPD" amino acids 39 to 342 (304 residues), 225.9 bits, see alignment E=1.4e-70 PF04717: Phage_base_V" amino acids 410 to 477 (68 residues), 27.1 bits, see alignment E=8.6e-10 PF13296: T6SS_Vgr" amino acids 496 to 598 (103 residues), 119.7 bits, see alignment E=1.3e-38 PF10106: DUF2345" amino acids 616 to 764 (149 residues), 159.2 bits, see alignment E=1.4e-50

Best Hits

KEGG orthology group: None (inferred from 66% identity to kpn:KPN_02273)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (835 amino acids)

>EX31_RS01945 type VI secretion system tip protein VgrG (Rahnella sp. WP5)
MMDIAQDLLSLSKTTLNRYRLSVPSCQAELDVESFTGSEAMSQLYRYTVTFTSTAKDIDS
GELLRQPATFTMSSGPLATLSEQKVVHGVITDFRRISGSADQVQYQITLEPFLALLAKQF
RTHRFFVNKSVPDVIEQVLTEHGLKGWEFEFSLKQTYPKREQINQYQESDLAFIERLLSE
LGIFYFFSLQPDAQTEVIHFADKQSAYQFGKTLPLNSPSGMSDSGADSVWGVNIQHSVVQ
AGVSSKDYNHRQAQQVLQSARADMTCGAGEGITYGEVYHYKPRHPETGGKTDPAAETANF
MARLDHESFLSQQTTLSFFSNDATLQPAQVLTITDSAIPSTLPELLTSPVVLIHAHFSGS
RKDALKVRLMAAPYSETLCWRPALLPRPVVSGTLMARVTSAKTNDIYAWQDVSGLYRVRF
DADQDDKAQGQESMPVRFAKPYGGDEYGIHFPLIQGTEVAIAFHDGDPDRPYIAHALHDS
RHTDHVTEQNNTRNVIRTPANNKLRMEDKRGEEHIKLSTEYGSKTQLNLGHNVDASRALR
GEGFELRTDEWGAIRAGKGIFISADEQPAASGKQLEMDDAIAQLEQALTLARSLAKVAEI
AKATPGDTDSQEALNTSLKKLKAAGILMSAPQGIGIVSPSAVRVASGSQSVGVMSGSNTD
ISSGKSFTAAAGESVSLFAQKSGMKLFAGKGKVDIQAQGDELSALAKNDITVTSTESTVT
ITAAKELILTCGGGYIKLSDGNIEIADPQNILFKSANWQKMEPANLNTPPVVFPKGYGAV
YALQDEEGNTIPSTEYRITTAEGTIYTGISDENGKTMKVYTNAPEKMNIEILGTR