Protein Info for EX31_RS01910 in Rahnella sp. WP5

Annotation: lipase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 353 to 372 (20 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details PF01764: Lipase_3" amino acids 282 to 418 (137 residues), 74.4 bits, see alignment E=4.3e-25

Best Hits

Predicted SEED Role

"COG3675: Predicted lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (649 amino acids)

>EX31_RS01910 lipase family protein (Rahnella sp. WP5)
MATQQAYTSASPQNQDAYTGKQKPYWVEIQLVDEEGKAVANMPWQAENSATPGGYEKELK
GTSDATGLIRIEPRYGSELRLFIDAQPLAKEMEQRSLRVSRELNDSTVRNDAEENGHIWH
YAVIGELCRTVPDIEQREGEPFPPPFHFPADKSFKGFKIRTNELEQRHVIEICPFRAWEL
VLHHQKDYSMANAINLGVAASLAYADDSSIDEASISHFFINQCQKLSRLPQLHKGDYSTN
ALVKDVSFSKRYFPPVYMDSTKAAEPDGDTQLFYVYNDDNVIVAWRGTASFWDGVADGSF
RPVESESCDIKLQCTELVSKGKVHYGFWDGYSVVERKFQNEIKKLQTVIKGRYLYICGHS
LGGALALIHAASLKSQMPILYTYGMPRTFTRDAVSQLSDITHYRHVNETDPVPALPPEAN
LDNWFYNLWGPLGVVLGGVWSTLELGAYQLKEWGDCFWHHGNTVAFLDTTQSRVWKECKV
TLPYPRNCMTIRKRLPLSVTLYLAPCLAEGSALAAGEQQKEFKNKLTREDLLEFFPKGTN
PARGTALNIFKHFMTSYMPYINNKLLELIYQEELSLGDSFSEHQDRIEAFKNQINENLTE
IPENELKRNRLFLELEELLKVSITPTLSSEKGNIIMQRFSLYGEEEIEQ