Protein Info for EX31_RS01880 in Rahnella sp. WP5

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 885 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 865 (854 residues), 1121.4 bits, see alignment E=0 PF13191: AAA_16" amino acids 218 to 319 (102 residues), 34.4 bits, see alignment E=1.5e-11 PF00004: AAA" amino acids 241 to 371 (131 residues), 38.7 bits, see alignment E=5.9e-13 amino acids 618 to 736 (119 residues), 26.4 bits, see alignment E=3.7e-09 PF17871: AAA_lid_9" amino acids 381 to 472 (92 residues), 112.1 bits, see alignment E=5.2e-36 PF07724: AAA_2" amino acids 613 to 777 (165 residues), 178.5 bits, see alignment E=5.3e-56 PF07728: AAA_5" amino acids 617 to 738 (122 residues), 37.5 bits, see alignment E=1.1e-12 PF10431: ClpB_D2-small" amino acids 788 to 862 (75 residues), 50.3 bits, see alignment E=9.2e-17

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 84% identity to eay:EAM_0373)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (885 amino acids)

>EX31_RS01880 type VI secretion system ATPase TssH (Rahnella sp. WP5)
MEHQSAVLLRRLNPYCAKALEAAATLCQTRAHNEITVEHWLLKLLELGEGDITVLARRYE
WDMDALWQSLLAHLDALPRSVHSRPQLSQDLQSLMKAGWLAASLQDDNQSIRSVNLLEAL
MAQPRLLRCEGLWPLFSLSEEHIRRLKPVLDALSEERPELQQQESLSRTPSALSESSATQ
KAESGVTGQSLSEALQAALDKFTLDVTAKAKAGQIDPVFGRDNEIRQMVDILSRRRKNNP
ILVGEPGVGKTALVEGLALRISEGNVPDSLKTVSLRTLDLGLLQAGAGVKGEFEQRLKNV
IDAVQQSPTPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQY
FERDAALERRFQIVKVDEPDDEMACLMLRGLKSRYAQHHGVHITDEAVKAAVSLSRRYIT
GRQLPDKAVDLLDTASARVRMSLDTLPEDLTRLKAQITALEMEEQALLEDIALGNKTHGD
RLEQIERQTDSLGEQLTTLDTQYHAEKALTHKLLEIRQDISRQEDIHALQQELAQLQGSA
PLLSLDVDVRTVATVIADWTGVPLTSLLKDEQTDLLQLENHLNKRVVGQDHALTDMAQRL
RAAKTGLTSENGPLGVFLLVGPSGVGKTETALSLADCLFGGEKSLITINLSEYQEAHTVS
QLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVINLFYQVFDRGFMRDGEG
REIDFRNTVILMTANLGSDHLMQLLDEQPETTDSDLQELLRPILRDHFQPALLARFQTLI
YRPLNVVALRTIVEMKLAQVAKRLNKHYGLTCSIEESLYDTLVAACLLPDTGARNIDSLL
NQQILPVLSQQLLQRMAAQQRTTALALGWDEDEGITLEFDDAAAE