Protein Info for EX31_RS01870 in Rahnella sp. WP5

Annotation: OmpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details PF00691: OmpA" amino acids 444 to 540 (97 residues), 66.8 bits, see alignment E=9.3e-23

Best Hits

KEGG orthology group: None (inferred from 57% identity to ses:SARI_02730)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>EX31_RS01870 OmpA family protein (Rahnella sp. WP5)
MRGLTQLILLLLATCLSLWLILGFWPLGTGSRMALSMLVVIISGATGYIQWRKNHRNEIA
YAHISDAVLPPEDFQGAVVLVCGDSAPLFSDSVPFRETGQGWYLPVTFPEHLPLLAQHLA
AERPALIAQISILLAIVPEQHQDKDDFAQKLHVWHRAIVQCKNWLAGIPPVWVSTWLSPP
VVTDTLAERWFTIIPGNKNVQVHEAGAGVIPLMDWSQQLDIRNTQERLSTVFWIESLLPW
LETHVCSILTRQQSDVPSLTPCAWGACFTPVAGSLDNLWQAHIGDVTTLTPGVVHSQECL
PLPEVLLPYLPQRHGVSRLMQACQLAGLLCGVFLLFALLASFVNNQRLVQSVDDHLALYN
RLSGTPSSPKMIAQQQLRTDAGLLDGWLRSGAPMRMSLGLYQGMRLIAPLETAINSWTPP
PPPPPVINQIVQGPKTIRLDSLSLFDVGKSELKTSSTKVLINALVGIKAKPGWLIVVAGH
TDDTGDDKSNQMLSLRRAESVRNWMRDTGDVSESCFAVQGYGESRPVATNDTPEGRAANR
RVEISLVPQADACKASATPSSSND