Protein Info for EX31_RS01865 in Rahnella sp. WP5

Annotation: DotU family type IV/VI secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 183 to 202 (20 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 10 to 208 (199 residues), 156.1 bits, see alignment E=5.7e-50 PF09850: DotU" amino acids 11 to 204 (194 residues), 131.4 bits, see alignment E=1.8e-42

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 62% identity to esa:ESA_pESA3p05494)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>EX31_RS01865 DotU family type IV/VI secretion system protein (Rahnella sp. WP5)
MSKINGSIVDEVFYPCWLMVSQLRNGQKIEDGEALYRRACDWIDGARESLSRAGFSESSC
DHMLYTQCALLDESVLNRQEPDSGNTKWLKDPLQARYFNTLNAGEELWERIRKVLHEPAP
DIAVLTCFYRALTLGFSGRYREQGDERREDVVRKLNQLVPPFASAQEMPIVSRSLRLRSG
RRTYWFSWVAGIVILIALWFVLNTQLTRMVSQLTGNH