Protein Info for EX31_RS01305 in Rahnella sp. WP5

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 16 to 248 (233 residues), 199.9 bits, E=6.5e-63
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 21 to 214 (194 residues), 64 bits, E=2.1e-21
• PF02358: Trehalose_PPase
  • amino acids 22 to 227 (206 residues), 149.2 bits, E=1.1e-47

Best Hits

Swiss-Prot: 58% identical to OTSB_SALTY: Trehalose-phosphate phosphatase (otsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 100% identity to rah:Rahaq_4454)

MetaCyc: 53% identical to trehalose-6-phosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Trehalose-phosphatase. [EC: 3.1.3.12]

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Protein Sequence (260 amino acids)

>EX31_RS01305 trehalose-phosphatase (Rahnella sp. WP5)
MQENTTETPLLPVLDSRQYAFFFDVDGTLAEIRAEPDAVTIPAEVRDHLQTLFAASSGAL
ALVSGRPVEQLDQLVSPLVLPAAGVHGAEMRDGNGTLHRVTLPDDVAQEVQQTLEAGMAA
LPGTLLETKGMAFALHYRQAMLHQQQVLALAESVVAKFPELVLQPGKCVLEIKPRGKDKG
AAIYTFMQQTPFSGRIPVFVGDDLTDEKGFEVVNAMQGITVKVGEGSSLAHYRVKTVRDV
YRWIEALQRHTLTFNKESEL