Protein Info for EX31_RS01180 in Rahnella sp. WP5

Annotation: two-component system response regulator DcuR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 198 to 216 (19 residues), see Phobius details PF00072: Response_reg" amino acids 4 to 117 (114 residues), 74.4 bits, see alignment E=4.2e-25

Best Hits

Swiss-Prot: 75% identical to DCUR_ECO57: Transcriptional regulatory protein DcuR (dcuR) from Escherichia coli O157:H7

KEGG orthology group: K07703, two-component system, CitB family, response regulator DcuR (inferred from 100% identity to rah:Rahaq_5033)

Predicted SEED Role

"Fumarate respiration transcriptional regulator DcuR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>EX31_RS01180 two-component system response regulator DcuR (Rahnella sp. WP5)
MINVLIVDDDAMVAELNRCYVGQIDGFACCGTASTLQQAKDLVLNSELSIDLILLDVYMQ
QDNGLDLLPELRNARRPVDVIVISSAADAETIKKSLNYGVVDYLIKPFQFSRFEEALTGW
QQKKTLMDNQQYYEQSDVDRLIHGNNTAAADTKKLPKGLTLQTLRTLCQWIDAHPTMEFS
TDELATSVNISRVSCRKYLIWLAQMNILFTSIHYGVTGRPVYRYRLQADHYSLLKQYCQ