Protein Info for EX31_RS01115 in Rahnella sp. WP5

Annotation: ABC-F family ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00005: ABC_tran" amino acids 21 to 154 (134 residues), 93.3 bits, see alignment E=9.1e-30 amino acids 318 to 445 (128 residues), 60.6 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 75% identity to srs:SerAS12_2526)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>EX31_RS01115 ABC-F family ATP-binding cassette domain-containing protein (Rahnella sp. WP5)
MTTLLSAQSLSFDNAFGPLLAEISFGLKKGDRIGLIGHNGCGKSTLLKILSGELAASSGT
VTLANQCLMARVEQHLPAELNDCTLLESVLGHLPGSLHQPEPWQAQVLLSDLGFDENAWE
LTAGTLSGGQHTRLLLARALIHQPDLLLLDEPSNHLDLPTLLWLEQFLKNWAGSFVLVSH
DRSLLDSVTNSTWILRDKTLQFIRLPCTQARQALEEKDIADALRRKAEQKEIDRVTLSAK
RLAVWGSVYDNEGLARKAKQMEKHVVRMKEDQTDVTAGNQWKLRLNGEALAADRVLALAD
LQVRPAPDAPVLFTLDEMRVKSGDRIALVGRNGCGKSSLLHSLWQAFICPETTVKGVIFH
PRVRMGYYDQNQHQLQDNDSLSDALAHFAPLTEEQRKMALIGAGFPYIRHQQKVSTLSGG
ERSRLLFIGLTLANYSLLLLDEPTNHLDLEGKEELAETLKTFSGAVLMVSHDRTLIEQSC
NRFWLIDQQRLEEWHSPAPVYAILAGTVPRADAPVSDVRLESVVIQETEEERLLATLMAL
ENKLEDDLARKPKHQKPELQRQWQQKIDELNALLDLL