Protein Info for EX31_RS01095 in Rahnella sp. WP5

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details PF00950: ABC-3" amino acids 14 to 267 (254 residues), 290.6 bits, see alignment E=5.7e-91

Best Hits

Swiss-Prot: 64% identical to YFED_YERPE: Chelated iron transport system membrane protein YfeD (yfeD) from Yersinia pestis

KEGG orthology group: K11606, manganese/iron transport system permease protein (inferred from 100% identity to rah:Rahaq_4947)

Predicted SEED Role

"Manganese ABC transporter, inner membrane permease protein SitD" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>EX31_RS01095 metal ABC transporter permease (Rahnella sp. WP5)
MMSWFDVLMEPLSFDFMQRALLTAAATSIVCAMFSCFLVLKGWSLMGDAISHAVLPGVVL
AYLAGIPLVIGAFGSGLFCAVATGFIKEHCRVKEDSVMGIVFSGMFAGGLVLFSRVNTEQ
HLSHILFGNVLGVTDSEMLQTLIIAAVVTLAIILKFKDLMLFCFDPVQAKVIGLPVRFYH
YALLCMLALTIVAALQAVGVVLVVAMLITPGITAFLLCKTLTKMLVVSVTTSLFAAISGT
FISFYIDAATGPTIVLVQAAIFLLALTANLLRKSIKPRQAAPNT