Protein Info for EX31_RS01075 in Rahnella sp. WP5

Annotation: manganese-binding transcriptional regulator MntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF01325: Fe_dep_repress" amino acids 31 to 84 (54 residues), 43.9 bits, see alignment E=7.6e-15 PF13412: HTH_24" amino acids 32 to 77 (46 residues), 26.9 bits, see alignment E=9.8e-10 PF01047: MarR" amino acids 41 to 78 (38 residues), 31.4 bits, see alignment E=4.8e-11 PF12802: MarR_2" amino acids 42 to 78 (37 residues), 29.4 bits, see alignment E=2.5e-10 PF01022: HTH_5" amino acids 50 to 78 (29 residues), 22.4 bits, see alignment 3.2e-08 PF02742: Fe_dep_repr_C" amino acids 88 to 142 (55 residues), 42.7 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 72% identical to MNTR_ECOL6: Transcriptional regulator MntR (mntR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11924, DtxR family transcriptional regulator, manganese transport regulator (inferred from 99% identity to rah:Rahaq_4943)

Predicted SEED Role

"Mn-dependent transcriptional regulator MntR" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>EX31_RS01075 manganese-binding transcriptional regulator MntR (Rahnella sp. WP5)
MKEKKINPLLDVEEHAQGFLQVREAHRRELMDDYVELISDLIHEFGEARQVDLAARLGVS
QPTVAKTLKRLANAGLVHQLPYRGTFLTPEGERLAAENRERHNVVEAFFIALGISLETAR
LDAEGVEHHVSDETLEAFRRFTAEKKS