Protein Info for EX31_RS01060 in Rahnella sp. WP5

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR00099: Cof-like hydrolase" amino acids 5 to 259 (255 residues), 181.1 bits, see alignment E=2.9e-57 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 232 (228 residues), 64.8 bits, see alignment E=1.2e-21 PF08282: Hydrolase_3" amino acids 6 to 259 (254 residues), 187.2 bits, see alignment E=7.3e-59 PF05116: S6PP" amino acids 139 to 238 (100 residues), 25.8 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 100% identity to rah:Rahaq_4940)

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>EX31_RS01060 HAD family hydrolase (Rahnella sp. WP5)
MAVKLIAVDMDGTFLNPQHEYNKIRFREQYQQLLARDIKFVVASGNQYYQLKSFFDDIDE
QIAYVAEGGGYVVDKKEEVYCGKLEPEQVADVLHWISRTPGINTIVCGRKGAYVLNGTDE
AFISRMRRYYHRLSKVSDYAEINDTIFKFALSYREDDVYPLMGEITRHLGNIVAPVTSGH
GSVDLIISGNHKACGLQKIQKIYGIRDEEVLAFGDSGNDLEMLSYCGFGFAMENASAAAK
AAAKYTAPSNSDEGVLNIIDDVLNDRAPFA