Protein Info for EX31_RS01015 in Rahnella sp. WP5

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 856 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 825 (813 residues), 1074.9 bits, see alignment E=0 PF00004: AAA" amino acids 216 to 347 (132 residues), 44.4 bits, see alignment E=1.1e-14 amino acids 584 to 726 (143 residues), 25.9 bits, see alignment E=5.9e-09 PF17871: AAA_lid_9" amino acids 356 to 448 (93 residues), 105.1 bits, see alignment E=9e-34 PF07724: AAA_2" amino acids 578 to 743 (166 residues), 187.8 bits, see alignment E=7.8e-59 PF07728: AAA_5" amino acids 583 to 704 (122 residues), 39.7 bits, see alignment E=2.4e-13 PF10431: ClpB_D2-small" amino acids 752 to 826 (75 residues), 36.4 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 99% identity to rah:Rahaq_4931)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (856 amino acids)

>EX31_RS01015 type VI secretion system ATPase TssH (Rahnella sp. WP5)
MGNYLKKIVEKMNVEARECLDAAISLAVSRTHHEVDIEHLLLALVTRQPALIEQLCLNAG
LRGDALVDALKVSLNHLRSGNTRSPVLSELLVEHLEKSWLHASACWQQTQLPVQAFLGSL
LASEKDNQIHLSSALQQALLCQVDRADRLLHDACAPAQATNHPAATRHNTDSAVMKFTRN
LTEQARDAALDPALGREPEIRQLIDVLLRRRQNNPVLTGEPGVGKTALVEGLAQRIADGT
VPEALKSMEILSLDMGLLQAGASVKGEFENRLQTLLREVKEYPSPVILFIDEAHTLIGAG
GQAGQNDAANLLKPALARGEMRVVAATTWAEYKKYFEKDAALARRFQVIKVAEPDEETAI
AMLRSLKPALSKHHGVQILESALVAAVRLSSRYISGRQLPDKSISLLDTACARVAISQCH
EPKEIEDLNAMISNIHTERESLLKEGENPSRVKWLDQRESELKQSLEALLPVWRQQQQIV
AQINSIEDVAQIAALRAQLAEMHKDQALVYDCVDATCVADVIAGWTGIPLGRMMEKEQQQ
LGDLVARLESRVIGQSHALADIAQQIRIGRANLADPVKPTGVFMLAGPSGVGKTETALAL
SELLFGGEQSLITINMSEYQEAHSVSGLKGSPPGYVGYGQGGVLTEAVRRRPYSVVLLDE
VEKAHPDVMEIFYQVFDKGVMEDAEGQLINFRNTLIILTSNLASDRVMTACAAGNTDQKA
LTALLRPEFDQYFRPALMGRLQLIPYLPVVGETLAKIIRLKIDKVCKRFSGAGEGNSSLS
YSEKVVEFMASRCQVEQSGAREIDAVLNRELLPLLTDRLLAVESKADIRLQVGVSKDQLT
LTKQPASKRSAAKQPV