Protein Info for EX31_RS00940 in Rahnella sp. WP5

Annotation: manganese efflux pump MntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details PF02659: Mntp" amino acids 32 to 183 (152 residues), 179.8 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 75% identical to MNTP_ERWT9: Putative manganese efflux pump MntP (mntP) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4916)

MetaCyc: 65% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>EX31_RS00940 manganese efflux pump MntP (Rahnella sp. WP5)
MQLYTILILAFGMSMDAFAAAIGKGASLHRPPLKEALRTGLIFGVIEAITPVIGWGIGLA
ASQFIMSWDHWVAFTLLLILGIRMIAEAFRKDKLEEDTQAPRRHGFWVLVTAAVATSLDA
MAVGVGLAFLQVNILVMALTIGAATTIMATSGMLLGRFLGAAMGKWAEILGGVVLIGIGT
SILIEHLGLLG