Protein Info for EX31_RS00885 in Rahnella sp. WP5

Annotation: transcriptional regulator CecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00440: TetR_N" amino acids 19 to 63 (45 residues), 44.1 bits, see alignment 1.4e-15 PF09209: CecR_C" amino acids 98 to 220 (123 residues), 115.5 bits, see alignment E=1.6e-37

Best Hits

Swiss-Prot: 63% identical to CECR_SHIFL: HTH-type transcriptional dual regulator CecR (cecR) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4904)

Predicted SEED Role

"Transcriptional regulator YbiH, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>EX31_RS00885 transcriptional regulator CecR (Rahnella sp. WP5)
MPTSQPPITSRGEQAKNSLIKAAIAQFGEYGLQATTRDIAALAGQNIAAITYYFGSKEEL
YIASAGWIADFINDNFLEHMQCAEEVMSQSPSDKAQIRQLIHTACEQMIRLLTSDETLNL
SKFISREQLSPTPAYQLIHDRVIAPMHSHLTSLVGRYTGRDPLDTETILHTHALLGQILA
FRLGRETILLRAGWTNFDKANRQQISSVVLTHVDFILLGLSVN