Protein Info for EX31_RS00835 in Rahnella sp. WP5

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 218 to 244 (27 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 5 to 259 (255 residues), 138.2 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rah:Rahaq_4894)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) / Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>EX31_RS00835 branched-chain amino acid ABC transporter permease (Rahnella sp. WP5)
MSEFLLHILCLAGIYAIIALALNLQAGYAGLLNFGHIVFVGTGAYAVGLGNNFGLPLWVV
IPAGLLCAIVISALMALLGRQLTADYWGIATLALAEIIRIAVVNEDALTGGAQGIGGLSS
PWSTGDTVTDTRIFAIIILFSVIVATLASLRIGASRFGRALRLMREQPQLAICMGYALPW
LKCRALMSSAVMCCLAGMLLAWYTDYVSPDYLLSSETFLIWSMVMIGGIGNVRGVLLGVL
LVEGLYNFIPFAKDYFHISSDLTGALRLGLVGLALLLCLLTRPGGLLPEKLRTFS