Protein Info for EX31_RS00810 in Rahnella sp. WP5

Annotation: translesion error-prone DNA polymerase V autoproteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00717: Peptidase_S24
  • amino acids 16 to 132 (117 residues), 101.8 bits, E=1e-33

Best Hits

Swiss-Prot: 60% identical to UMUD_ECOLI: Protein UmuD (umuD) from Escherichia coli (strain K12)

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 100% identity to rah:Rahaq_4889)

MetaCyc: 60% identical to DNA polymerase V protein UmuD (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone repair protein UmuD"

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7, 3.4.21.-

Use Curated BLAST to search for 2.7.7.7 or 3.4.21.-

Protein Sequence (139 amino acids)

>EX31_RS00810 translesion error-prone DNA polymerase V autoproteolytic subunit (Rahnella sp. WP5)
MQLIRPTEASQPVMLPLFSEKVPCGFPSPAQDYVEDRLDLNKLLIRHPSATYFIKVSGES
MHGAGISDGDLLVVDRSLSAVHGDIVIAAVSGEFTVKELRTHPYLQLVPHNDDYSSISFQ
NAEELEIFGVVIFSIKAHK