Protein Info for EX31_RS00655 in Rahnella sp. WP5

Annotation: pyrroloquinoline quinone biosynthesis protein PqqE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 15 to 375 (361 residues), 615.4 bits, see alignment E=2.8e-189 PF04055: Radical_SAM" amino acids 26 to 181 (156 residues), 100.1 bits, see alignment E=2.3e-32 PF13353: Fer4_12" amino acids 29 to 104 (76 residues), 23.2 bits, see alignment E=1.1e-08 PF13186: SPASM" amino acids 253 to 317 (65 residues), 26.2 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 97% identical to PQQE_RAHAQ: PqqA peptide cyclase (pqqE) from Rahnella aquatilis

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 100% identity to rah:Rahaq_4857)

MetaCyc: 84% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>EX31_RS00655 pyrroloquinoline quinone biosynthesis protein PqqE (Rahnella sp. WP5)
MLKSGLPSVNLLKPAVKPPLWLLAELTYRCPLQCPYCSNPLDFAKQEKELTTAQWIKVFE
EAREMGAVQIGFSGGEPLVRKDLPELIRAARDLGFYTNLITSGIGLTEKKIDAFAEAGLD
HIQISFQASDETLNAALAGNAKAFRQKLEMAKAVKAHGYPMVLNFVLHRHNIDQIDKIID
LSIELEADDVELATCQFYGWAQLNREGLLPTREQIARAENVVHQYREKMAGTGNLANLLF
VTPDYYEERPKGCMGGWGAIFLSVTPEGMALPCHSARQLPVEFPSVLENTLQEIWYDSFG
FNKYRGFDWMPEPCRSCSEKEKDFGGCRCQAFMLTGNADNADPVCSKSEHHGKILAAREQ
ANCTNIQINQLQFRNRANSQLIFKG