Protein Info for EX31_RS00640 in Rahnella sp. WP5

Annotation: FMN-dependent L-lactate dehydrogenase LldD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01070: FMN_dh
  • amino acids 13 to 375 (363 residues), 435 bits, E=3.1e-134
• PF00478: IMPDH
  • amino acids 238 to 342 (105 residues), 26.2 bits, E=5.9e-10
• PF01645: Glu_synthase
  • amino acids 293 to 336 (44 residues), 21.6 bits, 1.7e-08

Best Hits

Swiss-Prot: 95% identical to LLDD_PECAS: L-lactate dehydrogenase (lldD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to rah:Rahaq_4854)

MetaCyc: 85% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

• superpathway of methylglyoxal degradation (7/8 steps found)
• methylglyoxal degradation IV (3/3 steps found)
• methylglyoxal degradation V (3/3 steps found)
• L-lactaldehyde degradation (aerobic) (2/2 steps found)
• superpathway of fucose and rhamnose degradation (9/12 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Protein Sequence (387 amino acids)

>EX31_RS00640 FMN-dependent L-lactate dehydrogenase LldD (Rahnella sp. WP5)
MIISASTDYRAAAKSKLPPFLFHYIDGGAYNEHTLRRNTADLADIALRQRILKNMSDLSL
ETQLFGEKLAMPVVLAPVGLTGMYARRGEVQAARAAAKKGIPFTLSTVSVCPIEEVAPAI
DRPMWFQLYVLKDRGFMRNALERAQAAGVKTLVFTVDMPTPGARYRDAHSGMSGPNAAAR
RMLQAVMHPQWAWDVGLNGKPHDLGNVSAYRGKPTTLEDYIGWLGANFDPSISWKDLEWI
REFWKGPMIIKGILDPEDAKDAVKFGADGIVVSNHGGRQLDGVLSTAHALPAIADAVKGD
ITILADSGIRTGLDVVRMIALGADSVLLGRAFVYALAAAGEAGVINLLNLIEKEMRVAMT
LTGAKSIADISGDSLVYGRNQVHRATL