Protein Info for EX31_RS00565 in Rahnella sp. WP5

Annotation: UbiD family decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF20695: UbiD_N" amino acids 27 to 101 (75 residues), 49 bits, see alignment E=8e-17 PF01977: UbiD" amino acids 117 to 328 (212 residues), 191 bits, see alignment E=2.3e-60 PF20696: UbiD_C" amino acids 337 to 470 (134 residues), 102.5 bits, see alignment E=2.6e-33

Best Hits

Swiss-Prot: 56% identical to LPDC_LACPL: Gallate decarboxylase (lpdC) from Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to rah:Rahaq_4843)

MetaCyc: 63% identical to protocatechuate decarboxylase catalytic subunit (Klebsiella pneumoniae pneumoniae)
Protocatechuate decarboxylase. [EC: 4.1.1.63]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>EX31_RS00565 UbiD family decarboxylase (Rahnella sp. WP5)
MSKKESHPQNNNVHDLRSAIAFLESLPGEMVSTDVEVDPHAELSGVYRYVGAGGTCERPT
RKGPAMMFNTIKGFPGVRVVTGLMSTRERVGYLLNCAPEKLGFLLKDSVKNAIAPVVVDR
GTAPCQEVTYLADDPNFDLRTLLPAPTNTEEDAGPYFTMGMCYASDPETKESDITIHRLC
IQSRDELSMWLTPGRHIDAFREKAERAGKPLPISISIGVDPAIEIAACFEPPTTPLGFNE
LSIAGALRGKAVELTHCVSIDEKAIAHAEIVIEGELLPDVRVREDQNTNTGKAMPEFPGY
TGEAKAALPVIKVKAVTHRRNPILQTTLGPSGEHVSMAGIPTEASILDMIDRAMPGRVLN
VHAHTSGGGKLLAVLQFKKSSPVDKGRQRQAALLAFAAFSELKHVILVDEDVDIFDTDDI
LWAMQTRYQGDVDTVTIPGVRCHPLDPSQHPAYSPGILQEGMSCKTIFDCTVPFHLKAHF
ERSKFKDVDVKKFLPDFKY