Protein Info for EX31_RS00560 in Rahnella sp. WP5

Annotation: HAMP domain-containing histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 178 to 201 (24 residues), see Phobius details PF00672: HAMP" amino acids 199 to 255 (57 residues), 25.6 bits, see alignment 2.5e-09 PF00512: HisKA" amino acids 267 to 335 (69 residues), 61.5 bits, see alignment E=1.3e-20 PF02518: HATPase_c" amino acids 385 to 487 (103 residues), 77.2 bits, see alignment E=2.8e-25 PF14501: HATPase_c_5" amino acids 388 to 472 (85 residues), 24.6 bits, see alignment E=3.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4842)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>EX31_RS00560 HAMP domain-containing histidine kinase (Rahnella sp. WP5)
MKNLTLAQRLTLVFMVLLIACCALSGYMQVRSSNQYSQSVIQRLSANLATQIAANNPLLS
QGDWDPKAVHTLFDQLMAVNPSVEVYLLDKDGNIVGNAAPPGRLQQQKIDLAPVNALLHG
AKMPVYGDNPRDPQTPQVFSAAPLQVDGVTKGYVYIVLLGDEYTALTSDAQYQSAISLAL
RSMGLVALFGLLAGALAFRWVTRPVRKLTAQIAQLDSGGMDAIQALAKTDTPAGAARDEV
TQLQQAFVALAKRIDQQWQSLMVQDQQRREFIANISHDLRTPLTSLHGYLETLSVKAEHL
TNEDRQRYLNIALTQSKKVGRLAQELFELARLEYGVVKPQKEPFSLSELVQDVFQKFELA
TETRGQKLLADITPGIPLVNADLGMIERVLTNLLDNAIRFTPEGGVIEIKLWKQEGQVMV
QLKDSGPGIAPELKDSLFVRPSILSTNKHRAGGLGLMIVRRILQLHGSDIRLIEQPKHGA
CFQFSVPV