Protein Info for EX31_RS00525 in Rahnella sp. WP5

Annotation: type I methionyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00500: methionine aminopeptidase, type I" amino acids 17 to 260 (244 residues), 309.2 bits, see alignment E=1.1e-96 PF00557: Peptidase_M24" amino acids 25 to 253 (229 residues), 171.7 bits, see alignment E=9.3e-55

Best Hits

Swiss-Prot: 60% identical to MAP1_ECOL6: Methionine aminopeptidase (map) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to rah:Rahaq_4835)

MetaCyc: 60% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>EX31_RS00525 type I methionyl aminopeptidase (Rahnella sp. WP5)
MNNGLDSRYFVNNNRMIKTPEGIDKARIAGKLAARVLHMITPYVVPGVTTNELDRICHDF
IVNELQAIPANIGYHGYQKTTCTSVNHVICHGIPSDKALKKGDIVNIDVALIKDGWYGDT
SRMYYAGEPGIMARRLVDTTYEAMMAGIAVVRPGATLGDVGFAIAAVAKREGFSIVEEYC
GHGIGMGYHEDPQVLHYGEQGHGLVLQEGMLFTIEPMLNAGKKQNKVLPDGWTVVTKDHS
LSAQWEHMIAVTKDGYEILTPWPEDK