Protein Info for EX31_RS00380 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 167 (147 residues), 123.4 bits, E=1.1e-39
• PF13304: AAA_21
  • amino acids 119 to 202 (84 residues), 31.4 bits, E=2e-11

Best Hits

Swiss-Prot: 43% identical to AMIF_STRPN: Oligopeptide transport ATP-binding protein AmiF (amiF) from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 99% identity to rah:Rahaq_4797)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Protein Sequence (256 amino acids)

>EX31_RS00380 ABC transporter ATP-binding protein (Rahnella sp. WP5)
MIDVRNLNLSFGEGAKTTQVLTDVNIAVREGEIFGLVGESGSGKTTVLKCLAGLFTHWKG
ELEIDGQQLEHRIGRERCRLVQMVFQDPYGSLHPRHTIGDILEEPLQIHRIDQREQRINT
ILEKVGLNRAFRSRYPHQLSGGQRQRVAIARALILKPRVLLLDEPTSALDVSVQAEILNL
LFDLQKEEGLTYLMVTHDLGVIAHLCQRVAVMKYGKILETLDTDALLRGDIRDDYTRVLV
DASRDYSREMAAKVML