Protein Info for EX31_RS00225 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 305 (255 residues), 147.7 bits, see alignment E=1.9e-47

Best Hits

KEGG orthology group: K10561, rhamnose transport system permease protein (inferred from 100% identity to rah:Rahaq_4765)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 1" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>EX31_RS00225 ABC transporter permease (Rahnella sp. WP5)
MAVTPFFRRLMCWEGFLLLVTLLVFVVNAFASPYFLNIWNLSDATFNFTEKAIIVLPMAM
LIIAREIDLSVASTMALSSTIMGFCAQAGLPTPALVGVGLSVGLLCGLINGLLVTRLNLS
SIVITIGTMSLFRGITYVLLGDQSLNKYPASFAWFGQGYVWGPLSFEFALFLVLGAVFYF
LLHKTNFGRRTYAIGNNPVAAWYSGINVKRHNLTLFVLVGVMSGLAAVLLTSRLGSTRPT
LALGWELSVITMAVLGGVSVLGGSGSMTGVIIAAFLMGLLTFGLSLLNVPGIVMSVIVGA
MLIVVISLPVLYRKVLARGK