Protein Info for EX31_RS00130 in Rahnella sp. WP5

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 209 to 368 (160 residues), 146.5 bits, see alignment E=3e-47 PF00990: GGDEF" amino acids 214 to 364 (151 residues), 122 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_4743)

Predicted SEED Role

"response regulator receiver domain protein (CheY-like)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>EX31_RS00130 GGDEF domain-containing protein (Rahnella sp. WP5)
MIYSSWKWVVLLPLLTKPVSFVLFGGVVSSLIIFPLLYSQDVQEWKGNINNIQNMGSFYD
SDNLQGDISAGNYIRNPSQYTEVQVKTLLFSKSGNPQECNAKIREFLTSVKKIQPHNIPV
VLNKVCANRGFAIGRFADENTIISILPLHDKGYSLVGVKIRKYSILGKPAFSKSIMNFSN
VWPALIIIILSMVISYLLSLIAGGYLRVLNEYASKDGLTGCLRREAFYAKASYELEKSKK
NNVPFSVLVIDLDHLRDVNNTYGHAKGDTAISLIAETILKSLRGTDFVGRVGGDEFIVIL
KDTTPADALLIANRIRHSVKSLKLDDLSLSVSIGISQCEKQNATLQEIISKADTNLYLAK
RQRNEVVFENDILR