Protein Info for EX31_RS00105 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 36 to 59 (24 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 220 to 408 (189 residues), 31.9 bits, see alignment E=5.6e-12

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to rah:Rahaq_4738)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>EX31_RS00105 ABC transporter permease (Rahnella sp. WP5)
MSQTEMLTTPVTEGSAEGPTLRQRLRKVEAAYTRRSLLLIAPLLLFVIVSFLFPIASILG
KSVTNPELGATLPETVAQLAHWDGKTVPDEATFTALVTDLRHARSSGQMATIAKRLSYED
NRYRSLITGTLRQVPAGGGAIREPLIQSMPLWGELSTWQTLQRASGPVTSLYLLSAFDRK
VDVDTGKIVALPPDQALYVNVLLRTLWMALVVTICCVVLGYPLAYWLAKQPSGRANLLMI
LVLLPFWTSLIVRTASWIVLLQSGGLINRALLSTGIIDHPLVMVFNRLGVYISMTHIMLP
FIVLPLYAVMKGISPNYVRAAISLGAHPFSAFWRVYVPQTYAGVTAGALLVFMMAIGYYI
TPALLGGPGDQMVSYFVAFFTNTTMNWGMAAALGSQLLVIVVLLYIVYIRVTRTKAEIAA
H