Protein Info for EX31_RS00085 in Rahnella sp. WP5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00005: ABC_tran" amino acids 21 to 163 (143 residues), 133.4 bits, see alignment E=9.1e-43 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 36 to 353 (318 residues), 371 bits, see alignment E=2.4e-115 PF08402: TOBE_2" amino acids 280 to 356 (77 residues), 66.9 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to rah:Rahaq_4734)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>EX31_RS00085 ABC transporter ATP-binding protein (Rahnella sp. WP5)
MRTYVSFKNIKKSYDGDKLVVKNLNLDVHEGEFLTLLGPSGSGKTTSLMMLAGFETPTQG
EILLRDKPLHNLPPHQRDIGMVFQNYALFPHMTVAENLAFPLTIRRLNKSDIKEKVDRIL
DMVKLKSLADRYPAQMSGGQQQRVALARALVFEPKLVLMDEPLGALDKQLREHMQMEIKQ
LHKMLDLTIVYVTHDQSEAMTMSDRVAVFNDGVIQQMDSPNVIYEKPDNAFVAQFIGENN
SLLATNNAAEGDYYRASLDDGTQLRAVKIRPSSPGKKILLSIRPERIHVNNPQPGTEQVK
ARIQQFIYLGDHVRMMTEVAGQDNFMVKLSAAAMKPEWQPGAEVLLSWQPEHLRALDVVT
H