Protein Info for EX31_RS00060 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details amino acids 28 to 29 (2 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 74 (74 residues), 32.8 bits, see alignment E=6.8e-12 PF00528: BPD_transp_1" amino acids 112 to 316 (205 residues), 140.8 bits, see alignment E=4.2e-45

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to rah:Rahaq_4729)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>EX31_RS00060 ABC transporter permease (Rahnella sp. WP5)
MRNFILRRLLQTIPMLFLASLLIFMLFAKTPGDFIDGNITLTAQRAAELKALYGLDQPLL
SRYLHWLGNLLRGDLGFSLQYQIPVSQLLNQYIWNSFLLATIAMVLYWGIALAVGIVSAM
KPYSLFDHVVSIVIFAAMSFPTFFLCLLLIKWFAVDLHWLPVGGMTNTGSDATGWAWVMQ
VAAHLVLPVVALVMLQAGSLTRYFRASMLDVVRMDFIRTARAKGLRERTVILKHALRNAL
LPIITLLGFELPGLFSGALITEKVFNWPGAGHIHIDSLAARDYPVLMGFTLFLAVLTILG
NLIADVLYAWADPRIRVRS