Protein Info for EX31_RS00045 in Rahnella sp. WP5

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00005: ABC_tran" amino acids 34 to 184 (151 residues), 110.2 bits, see alignment E=1.9e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 234 to 320 (87 residues), 97.7 bits, see alignment E=1.6e-32 PF08352: oligo_HPY" amino acids 236 to 300 (65 residues), 68.3 bits, see alignment E=8.8e-23

Best Hits

Swiss-Prot: 49% identical to Y4TS_SINFN: Probable peptide ABC transporter ATP-binding protein y4tS (NGR_a01400) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to rah:Rahaq_4726)

MetaCyc: 49% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX31_RS00045 ATP-binding cassette domain-containing protein (Rahnella sp. WP5)
MSAEYLIEVDGLKKYFPIRDGVFGQETGQLRAVDGVSFNIRKGTIFGLVGESGSGKTTVG
RTLLGLYDKTAGSVKFRGEDLHGLKPKQLKALRPKIQLVFQDPYSSLNPRIRIGDAIGEA
MLEHKLCTRAQLHGKVLEVMKICGLSPLHYNRFPHEFSGGQRQRIGIARALILQPDFIIA
DEPISALDVSIQAQIINLFADLRDDHGVTFLFISHDLGVVEHLCDDVAVMYLGQLVETAS
RDALFCQPLHPYTQALLAAVPTLDPDSEPVAMVSGEIPDPSKPPAGCRFHTRCPCATDRC
HKEIPLLREVESGHHVACHLV