Protein Info for ECOLIN_RS25140 in Escherichia coli Nissle 1917

Annotation: YjjI family glycine radical enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 TIGR04040: glycine radical enzyme, YjjI family" amino acids 11 to 504 (494 residues), 788 bits, see alignment E=1.5e-241 PF11230: YjjI-like" amino acids 22 to 504 (483 residues), 729.1 bits, see alignment E=9.7e-224

Best Hits

Swiss-Prot: 100% identical to YJJI_ECOLI: Uncharacterized protein YjjI (yjjI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4380)

Predicted SEED Role

"FIG00638118: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>ECOLIN_RS25140 YjjI family glycine radical enzyme (Escherichia coli Nissle 1917)
MPTSDENALQQRCQQIVTSPVLSPEQKRHFLALEAENNLPYPQLPAEARRALDEGVICDM
FEGHAPYKPRYVLPDYARFLANGSEWLELEGAKDLDDALSLLTILYHHVPSVTSMPVYLG
QLDALLQPYVRILTQDEIDIRIKRFWRYLDRTLPDAFMHANIGPSDSPITRAILRADAEL
KQVSPNLTFIYDPEITPDDLLLEVAKNICECSKPHIANGPVHDKIFTKGGYGIVSCYNSL
PLAGGGSTLVRLNLKAIAERSESLDDFFTRTLPHYCQQQIAIIDARCEFLYQQSHFFENS
FLVKEGLINPERFVPMFGMYGLAEAVNLLCEKEGIAARYGKEAAANEVGYRISAQLAEFV
ANTPVKYGWQKRAMLHAQSGISSDIGTTPGARLPYGDEPDPITHLQTVAPHHAYYYSGIS
DILTLDETIKRNPQALVQLCLGAFKAGMREFTANVSGNDLVRVTGYMVRLSDLEKYRAEG
SRTNTTWLGEEAARNTRILERQPRVISHEQQMRFSQ