Protein Info for ECOLIN_RS25030 in Escherichia coli Nissle 1917

Annotation: DNA replication protein DnaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00308: Bac_DnaA" amino acids 66 to 178 (113 residues), 27.2 bits, see alignment E=5.3e-10 PF01695: IstB_IS21" amino acids 92 to 238 (147 residues), 57.9 bits, see alignment E=1.7e-19 PF00004: AAA" amino acids 103 to 216 (114 residues), 27.9 bits, see alignment E=4.2e-10

Best Hits

Swiss-Prot: 100% identical to DNAC_SHIFL: DNA replication protein DnaC (dnaC) from Shigella flexneri

KEGG orthology group: K02315, DNA replication protein DnaC (inferred from 100% identity to eco:b4361)

Predicted SEED Role

"DNA replication protein DnaC" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>ECOLIN_RS25030 DNA replication protein DnaC (Escherichia coli Nissle 1917)
MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRAMKMQRTFNRS
GIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAIC
NELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYE
KVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSRV
TGKEY