Protein Info for ECOLIN_RS24880 in Escherichia coli Nissle 1917

Annotation: YjiG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 59 to 110 (52 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details PF07670: Gate" amino acids 27 to 111 (85 residues), 46.7 bits, see alignment E=2e-16

Best Hits

Swiss-Prot: 100% identical to YJIG_ECO57: Inner membrane protein YjiG (yjiG) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b4329)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>ECOLIN_RS24880 YjiG family protein (Escherichia coli Nissle 1917)
MTTQVRKNVMDMFIDGARRGFTIATTNLLPNVVMAFVIIQALKITGLLDWVGHICEPVMA
LWGLPGEAATVLLAALMSMGGAVGVAASLATAGALTGHDVTVLLPAMYLMGNPVQNVGRC
LGTAEVNAKYYPHIITVCVINALLSIWVMQLIV