Protein Info for ECOLIN_RS24650 in Escherichia coli Nissle 1917

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 6 to 276 (271 residues), 91.1 bits, E=4.9e-30
• TIGR00746: carbamate kinase
  • amino acids 6 to 301 (296 residues), 381.5 bits, E=1.3e-118

Best Hits

Swiss-Prot: 54% identical to ARCC_SYNY3: Carbamate kinase (arcC) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 100% identity to ecc:c5349)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

• allantoin degradation IV (anaerobic) (8/9 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• guadinomine B biosynthesis (3/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.2

Use Curated BLAST to search for 2.7.2.2

Protein Sequence (310 amino acids)

>ECOLIN_RS24650 carbamate kinase (Escherichia coli Nissle 1917)
MENKPTLVIALGGNALLKRGEPLEAEIQRKNIDLAAKTIAQLTQHWRVVLVHGNGPQVGL
LALQNSAYAHVAPYPLDILGAESQGMIGYMLQQALKNQLPQREISVLLTQVEVDANDPAF
SNPTKYIGPIYDHAQTQVLQAEKGWVFKADGHSFRRVVPSPQPKRIVERDAIQTLIAHDH
LVICNGGGGVPVVEKADGYHGIEAVIDKDLSAALLASQIHADALLILTDADAVYLDWGKP
TQRPLAQVTPELLNEMQFDAGSMGPKVTACAKFVSQCRGIAGIGSLADGPEILAGDKGTL
IRLDTPHNHA