Protein Info for ECOLIN_RS24465 in Escherichia coli Nissle 1917

Annotation: NAD(P)H:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF05368: NmrA" amino acids 2 to 220 (219 residues), 81.4 bits, see alignment E=1.7e-26 PF01370: Epimerase" amino acids 2 to 66 (65 residues), 21.9 bits, see alignment E=2.6e-08 PF01073: 3Beta_HSD" amino acids 3 to 106 (104 residues), 24.5 bits, see alignment E=3.2e-09 PF07993: NAD_binding_4" amino acids 4 to 42 (39 residues), 24.3 bits, see alignment 4.2e-09 PF13460: NAD_binding_10" amino acids 6 to 178 (173 residues), 71.9 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 98% identical to QOR2_ECOLI: Quinone oxidoreductase 2 (qorB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecp:ECP_4465)

MetaCyc: 98% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
1.6.5.-

Predicted SEED Role

"NADPH:quinone oxidoreductase 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>ECOLIN_RS24465 NAD(P)H:quinone oxidoreductase (Escherichia coli Nissle 1917)
MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALTAQGITVRQADYGDEAALT
SALQGVEKLLLISSSEVGQRAPQHRNVINAAKAADVKFIAYTSLLHADSSPLGLADEHIE
TEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAVAAAR
VISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKPITYQNLSEADFAAALKSVGLPDGL
ADMLADSDVGASKGGLFDDSKTLSKLIGRPTTTLAESVSHLFNVNN