Protein Info for ECOLIN_RS24425 in Escherichia coli Nissle 1917

Annotation: sugar phosphate isomerase/epimerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 98% identity to ect:ECIAI39_4673)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

plastoquinol-9 biosynthesis I (1/3 steps found)
L-tyrosine degradation I (2/5 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
vitamin E biosynthesis (tocopherols) (1/7 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>ECOLIN_RS24425 sugar phosphate isomerase/epimerase family protein (Escherichia coli Nissle 1917)
MRDLLQRPDLFSINTATLGYKTPLPAIIDACAARGIGAIAPWRRELQGEDLQQIARQLAA
SNINVSGLCRSTYYTAPTLAERKLAIDDNRRALDDAAVLNAACYMQVVGGLPMGTKDLYE
AREQVKQGIRQLLPHSKEVGVPIALEPLHPMTAADRSCLCTLRQALDWCDELDPDGEFGL
GVAVDVYHVWWDPDLASQILRAGKRILAFHVSDWLVPTTDLVNDRGMPGDGVINIPSIRR
LVENAGFNGAIELEIFSPYWWQKDINSTLDISVDRIAHYC