Protein Info for ECOLIN_RS24420 in Escherichia coli Nissle 1917

Annotation: enoyl-CoA hydratase/isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 14 to 257 (244 residues), 156 bits, E=1.2e-49
• PF16113: ECH_2
  • amino acids 16 to 240 (225 residues), 116.6 bits, E=1.8e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecc:c5301)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism (EC 4.2.1.55)

MetaCyc Pathways

• acetyl-CoA fermentation to butanoate (5/7 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.55

Use Curated BLAST to search for 4.2.1.55

Protein Sequence (258 amino acids)

>ECOLIN_RS24420 enoyl-CoA hydratase/isomerase family protein (Escherichia coli Nissle 1917)
MSDQPVLFSRAAASCRLTLNREDKCHAINEEMIESLDHYLNEIENDTALRLVELTATGDK
FFCAGGDIKSWSAYSPLDMGRKWIKRGNDVFNRLRNLPQLTVANLNGHTIGGGIELALCC
DIRIARPHAKFSNPEVMLGMVPGWMGIERVLNQVGPVVGRQMLMLGKRLTAQEAQAANLI
DEVVEKEQVESWMANQLAQLEKCGPVALAHIKQLILALENKHADYSHQLLAGLMSATQDC
QQATHAFAEKAGVSFHNQ