Protein Info for ECOLIN_RS24035 in Escherichia coli Nissle 1917

Annotation: divalent cation tolerance protein CutA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF03091: CutA1" amino acids 12 to 109 (98 residues), 118.2 bits, see alignment E=6.1e-39

Best Hits

Swiss-Prot: 100% identical to CUTA_ECOL6: Divalent-cation tolerance protein CutA (cutA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03926, periplasmic divalent cation tolerance protein (inferred from 99% identity to eco:b4137)

Predicted SEED Role

"Periplasmic divalent cation tolerance protein CutA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>ECOLIN_RS24035 divalent cation tolerance protein CutA (Escherichia coli Nissle 1917)
MLDEKSSNTTSVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEY
EVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR