Protein Info for ECOLIN_RS23595 in Escherichia coli Nissle 1917

Annotation: Sel1 family TPR-like repeat protein YjcO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF08238: Sel1" amino acids 37 to 66 (30 residues), 16.8 bits, see alignment 4.2e-07 amino acids 143 to 173 (31 residues), 23.9 bits, see alignment 2.5e-09 amino acids 181 to 215 (35 residues), 26.6 bits, see alignment 3.3e-10

Best Hits

Swiss-Prot: 100% identical to YJCO_ECOLI: Sel1-repeat-containing protein YjcO (yjcO) from Escherichia coli (strain K12)

KEGG orthology group: K07126, (no description) (inferred from 100% identity to eco:b4078)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>ECOLIN_RS23595 Sel1 family TPR-like repeat protein YjcO (Escherichia coli Nissle 1917)
MKKIITLMLFLTFFAHANDSEPGSQYLKAAEAGDRRAQYFLADSWFSSGDLSKAEYWAQK
AADSGDADACALLAQIKITNPVSLDYPQAKVLAEKAAQAGSKEGEVTLAHILVNTQAGKP
DYPKAISLLENASEDLENDSAVDAQMLLGLIYANGVGIKADDDKATWYFKRSSAISRTGY
SEYWAGMMFLNGEEGFIEKNKQKALHWLNLSCMEGFDTGCEEFEKLTNG