Protein Info for ECOLIN_RS23570 in Escherichia coli Nissle 1917

Annotation: cytochrome c nitrite reductase subunit NrfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF03916: NrfD" amino acids 5 to 318 (314 residues), 394.7 bits, see alignment E=2e-122 TIGR03148: cytochrome c nitrite reductase, NrfD subunit" amino acids 5 to 318 (314 residues), 466.7 bits, see alignment E=1.9e-144

Best Hits

Swiss-Prot: 99% identical to NRFD_ECOLI: Protein NrfD (nrfD) from Escherichia coli (strain K12)

KEGG orthology group: K04015, formate-dependent nitrate reductase complex, transmembrane protein (inferred from 99% identity to eco:b4073)

Predicted SEED Role

"NrfD protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>ECOLIN_RS23570 cytochrome c nitrite reductase subunit NrfD (Escherichia coli Nissle 1917)
MTQTSAFHFESLVWDWPIAIYLFLIGISAGLVTLAVLLRRVYPQAGGADSTLLRTTLIVG
PGAVILGLLILVFHLTRPWTFWKLMFHYSFTSVMSMGVMLFQLYMVVLVLWLAKIFEHDL
LALQQRWLPKLGIVQKVLSLLTPVHRGLETLMLVLAVLLGAYTGFLLSALKSYPFLNNPI
LPVLFLFSGISSGAAVALIAMAIRQRSNPHSTEAHFVHRMEIPVVWGEIFLLVAFFVGLA
LGDDGKVRALVAALGGGFWTWWFWLGVAGLGLIVPMLLKPWVNRSSGIPAVLAACGASLV
GVLMLRFFILYAGQLTVA