Protein Info for ECOLIN_RS22505 in Escherichia coli Nissle 1917

Annotation: HTH-type transcriptional activator RhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF02311: AraC_binding" amino acids 22 to 150 (129 residues), 83 bits, see alignment E=3.5e-27 PF07883: Cupin_2" amino acids 27 to 79 (53 residues), 28.2 bits, see alignment E=2.5e-10 PF00165: HTH_AraC" amino acids 185 to 226 (42 residues), 32 bits, see alignment 2e-11 amino acids 237 to 276 (40 residues), 46 bits, see alignment 8.4e-16 PF12833: HTH_18" amino acids 199 to 275 (77 residues), 80.6 bits, see alignment E=1.7e-26

Best Hits

Swiss-Prot: 100% identical to RHAR_SHIBS: HTH-type transcriptional activator RhaR (rhaR) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02854, AraC family transcriptional regulator, L-rhamnose operon transcriptional activator RhaR (inferred from 99% identity to eco:b3906)

Predicted SEED Role

"L-rhamnose operon transcriptional activator RhaR" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>ECOLIN_RS22505 HTH-type transcriptional activator RhaR (Escherichia coli Nissle 1917)
MAHQLKLLKDDFFASDQQAVAVADRYPQDVFAEHTHDFCELVIVWRGNGLHVLNDRPYRI
TRGDLFYIHADDKHSYASVNDLVLQNIIYCPERLKLNLDWQGAIPGFSASAGQPHWRLGS
VGMAQARQVIGQLEHESSQHVSFANEMAELLFGQLVMLLNRHRYTSDSLPPTSSETLLDK
LITRLAASLKSPFALDKFCDEASCSERVLRQQFRQQTGMTINQYLRQVRVCHAQYLLQHS
RLLISDISTECGFEDSNYFSVVFTRETGMTPSQWRHLNSQKD