Protein Info for ECOLIN_RS22260 in Escherichia coli Nissle 1917
Annotation: acyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to YIHG_ECOLI: Probable acyltransferase YihG (yihG) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 99% identity to eco:b3862)MetaCyc: 99% identical to 1-acylglycerol-3-phosphate O-acyltransferase YihG (Escherichia coli K-12 substr. MG1655)
1-acylglycerol-3-phosphate O-acyltransferase. [EC: 2.3.1.51]
Predicted SEED Role
"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)
MetaCyc Pathways
- superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
- phosphatidylglycerol biosynthesis I (6/6 steps found)
- phosphatidylglycerol biosynthesis II (6/6 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
- CDP-diacylglycerol biosynthesis I (4/4 steps found)
- CDP-diacylglycerol biosynthesis II (4/4 steps found)
- oleate biosynthesis III (cyanobacteria) (2/3 steps found)
- palmitoleate biosynthesis III (cyanobacteria) (1/2 steps found)
- phospholipid remodeling (phosphatidate, yeast) (1/2 steps found)
- CDP-diacylglycerol biosynthesis III (3/5 steps found)
- phosphatidate biosynthesis (yeast) (3/5 steps found)
- diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
- palmitoyl ethanolamide biosynthesis (2/6 steps found)
- superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
- stigma estolide biosynthesis (2/7 steps found)
- anandamide biosynthesis II (2/8 steps found)
- anandamide biosynthesis I (4/12 steps found)
- superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)
- plasmalogen biosynthesis I (aerobic) (1/16 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.51
Use Curated BLAST to search for 2.3.1.51
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (310 amino acids)
>ECOLIN_RS22260 acyltransferase (Escherichia coli Nissle 1917) MANLLNKFIMTRILAAITLLLSIVLTILVTIFCSVPIIIAGIVKLLLPVPVIWRKVSRFC DFMMYCWCEGLAVLLHLNPHLQWEVHGLEGLSKKNWYLLICNHRSWADIVVLCVLFRKHI PMNKYFLKQQLAWVPFLGLACWALDMPFMKRYSRAYLLRHPERRGKDVETTRRSCEKFRL HPTTIVNFVEGSRFTQEKHQQTHSTFQNLLPPKAAGIAMALNVLGKQFDKLLNVTLCYPD NNRQPFFDMLSGKLTRIVVHVDLQPIADELHGDYINDKSFKRHFQQWLNSLWQEKDRLLT SLMSSQRQEK