Protein Info for ECOLIN_RS21515 in Escherichia coli Nissle 1917

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 601 to 619 (19 residues), see Phobius details TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 622 (616 residues), 1016.9 bits, see alignment E=0 PF00890: FAD_binding_2" amino acids 8 to 37 (30 residues), 20.8 bits, see alignment (E = 6.2e-08) PF12831: FAD_oxidored" amino acids 8 to 152 (145 residues), 34.2 bits, see alignment E=5.5e-12 PF01134: GIDA" amino acids 8 to 398 (391 residues), 587.7 bits, see alignment E=3.5e-180 PF21680: GIDA_C_1st" amino acids 460 to 556 (97 residues), 107.7 bits, see alignment E=1.3e-34 PF13932: GIDA_C" amino acids 560 to 616 (57 residues), 86.5 bits, see alignment 2.6e-28

Best Hits

Swiss-Prot: 100% identical to MNMG_ECOLC: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to ecp:ECP_3940)

MetaCyc: 100% identical to 5-carboxymethylaminomethyluridine-tRNA synthase subunit MnmG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>ECOLIN_RS21515 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG (Escherichia coli Nissle 1917)
MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMI
FQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPS
IPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQV
PCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPE
GLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESK
FIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTL
GTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQRL
KSTWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTPFAPALTDEQAAE
QVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQ
ASRISGVTPAAISILLVWLKKQGMLRRSA