Protein Info for ECOLIN_RS21235 in Escherichia coli Nissle 1917

Annotation: small heat shock chaperone IbpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF00011: HSP20" amino acids 39 to 134 (96 residues), 80.4 bits, see alignment E=4.7e-27

Best Hits

Swiss-Prot: 99% identical to IBPB_ECO24: Small heat shock protein IbpB (ibpB) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K04081, molecular chaperone IbpB (inferred from 99% identity to eco:b3686)

Predicted SEED Role

"16 kDa heat shock protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>ECOLIN_RS21235 small heat shock chaperone IbpB (Escherichia coli Nissle 1917)
MRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLE
IQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQSFSLSFTLAENMEVSGATFVNGLLHIDLI
RNEPEPIAAQRIAISERPALNS