Protein Info for ECOLIN_RS20470 in Escherichia coli Nissle 1917

Annotation: 2,3-diketo-L-gulonate TRAP transporter substrate-binding protein YiaO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03480: DctP" amino acids 30 to 312 (283 residues), 360.4 bits, see alignment E=3.6e-112 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 30 to 286 (257 residues), 369.1 bits, see alignment E=5.9e-115

Best Hits

Swiss-Prot: 96% identical to YIAO_ECOLI: 2,3-diketo-L-gulonate-binding periplasmic protein YiaO (yiaO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eci:UTI89_C4123)

MetaCyc: 96% identical to 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"2,3-diketo-L-gulonate-binding periplasmic protein yiaO precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>ECOLIN_RS20470 2,3-diketo-L-gulonate TRAP transporter substrate-binding protein YiaO (Escherichia coli Nissle 1917)
MKLRSVTYALLIAGVATFSTSSLAAQSLRFGYETSQTDSQHIAAKKFNELLQEKTKGELK
LKLFPDSTLGNAQAMISGVRGGTIDMEMSGSNNFTGLSPVINLLDVPFLFRDTAHAHKTL
DGKVGDDLKVSLEGKGLKVLAYWENGWRDVTNSRAPVKTPADLKGLKIRTNNSPMNIAAF
KVFGANPIPMPFAEVYTGLETRTIDAQEHPINVVWSAKFYEVQKYLSLTHHAYSPLLVVI
NKAKFDGLTPEFQQALISSAQEAGSYQRKLVAEDQQKIIDGMKEAGVEVITDLDRKAFSD
ALGTQVRDMFVKDVPQGADLLKAVDEVQ