Protein Info for ECOLIN_RS19950 in Escherichia coli Nissle 1917

Annotation: DUF2776 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 107 to 134 (28 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details PF10951: DUF2776" amino acids 1 to 347 (347 residues), 512.7 bits, see alignment E=3e-158

Best Hits

Swiss-Prot: 90% identical to YHIM_ECOLI: Inner membrane protein YhiM (yhiM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecp:ECP_3581)

Predicted SEED Role

"FIG00638244: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>ECOLIN_RS19950 DUF2776 family protein (Escherichia coli Nissle 1917)
MNIYIGWLFKLIPLLMGIICIALGEFVLTGSGQSEYFVAGHVLISLSAICLALFTTAFII
ISQLTHGMNKFYNRLFPVIGYAGSATTMIWGWSLLASNNVMADEFVAGHVIFGVGMIAAC
VSTVAASSGHFLLIPKNASGSKSDGTPLQAYSSTIGDCLIAVPVLLTLFGFIWSVVLLRS
ADITPHYVAGHVLMGLTAICACLIGLVATIVHQTRNTFSVKEHWLWCYWVILLGSLTIIF
GIYVLISSDASARLAPGIILICLGMICYSIFSKVWLLALVWRRTCSLANRIPMIPVFTCL
FCLFLAAFLAEIAQTDMAYFIPSRVLVGLGAVCFTLFSIVSILEAGSAKK