Protein Info for ECOLIN_RS19295 in Escherichia coli Nissle 1917

Annotation: aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 53 to 232 (180 residues), 36.3 bits, see alignment E=3.9e-13 PF01053: Cys_Met_Meta_PP" amino acids 53 to 239 (187 residues), 29.2 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 96% identical to YHFS_ECOLI: Uncharacterized protein YhfS (yhfS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecq:ECED1_4034)

Predicted SEED Role

"Aspartate aminotransferase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>ECOLIN_RS19295 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme (Escherichia coli Nissle 1917)
MKTFPLQSLTLIEAQQKQFALVDTICRHFPGCEFLTCGDLGLTPGLNQPRITQRVEQVLA
DAFHAQAAALVQGAGTGAIRAALAALLKSGQRLLVHDAPVYPTTRVIIEQMGLTLITADF
NDLSALKQVVDEQQPDAALVQHTRQQPQDRYVLADVLATLRAAGVPALTDDNYAVMKVAR
IGCECGANVSTFSCFKLFGPEGVGAVVGDADVISRIRATLYSGGSQIQGAQALEVLRGLV
LAPVMHAVQAGVSERLLALLNGGAVAEVKSAVIANAQSKVLIVEFHQPIAARVLEEAQKL
GALPYPVGAESKYEIPPLFYRLSGTFRQANPQLEHCAIRINPNRSGEETILRILRESIAS
I