Protein Info for ECOLIN_RS19145 in Escherichia coli Nissle 1917

Annotation: 30S ribosomal protein S12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 TIGR00981: ribosomal protein uS12" amino acids 1 to 124 (124 residues), 232.1 bits, see alignment E=5.7e-74 PF00164: Ribosom_S12_S23" amino acids 12 to 123 (112 residues), 146 bits, see alignment E=1.7e-47

Best Hits

Swiss-Prot: 100% identical to RS12_SALNS: 30S ribosomal protein S12 (rpsL) from Salmonella newport (strain SL254)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 100% identity to eco:b3342)

MetaCyc: 100% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>ECOLIN_RS19145 30S ribosomal protein S12 (Escherichia coli Nissle 1917)
MATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK
RPKA